PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MLOC_79356.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
Family SRS
Protein Properties Length: 184aa    MW: 19280 Da    PI: 9.8823
Description SRS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MLOC_79356.2genomeIBSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF702115.86.2e-3696162268
        DUF702   2 rsgtasCqdCGnqakkdCaheRCRtCCksrgfdCathvkstWvpaakrrerqqqlaaasskaaasaa 68 
                   ++gt+sCqdCGnqakkdC h+RCRtCCksrgfdCathvkstWvpaa+rrer++q+ +as+++ ++ +
  MLOC_79356.2  96 GAGTISCQDCGNQAKKDCPHMRCRTCCKSRGFDCATHVKSTWVPAARRRERHHQQPQASAEQFKRPR 162
                   5789***********************************************8888777665544332 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF051421.1E-3299162IPR007818Protein of unknown function DUF702
TIGRFAMsTIGR016236.5E-28101143IPR006510Zinc finger, lateral root primordium type 1
Sequence ? help Back to Top
Protein Sequence    Length: 184 aa     Download sequence    Send to blast
MAGFPLGGGG HHSRGARDDD GSHPPGINPS ASSSSAAAFL YATTPSRGGF QLWQGQPQHE  60
QQQHPFYGGP SSSIIRFADD PAASGSSSRG GGRGSGAGTI SCQDCGNQAK KDCPHMRCRT  120
CCKSRGFDCA THVKSTWVPA ARRRERHHQQ PQASAEQFKR PREGGQPSST TPTTTSSGGS  180
ISSR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2412854e-50AK241285.1 Oryza sativa Japonica Group cDNA, clone: J065137A19, full insert sequence.
GenBankAP0053144e-50AP005314.2 Oryza sativa Japonica Group genomic DNA, chromosome 9, PAC clone:P0515E01.
GenBankAP0055674e-50AP005567.3 Oryza sativa Japonica Group genomic DNA, chromosome 9, BAC clone:OJ1254_E07.
GenBankAP0149654e-50AP014965.1 Oryza sativa Japonica Group DNA, chromosome 9, cultivar: Nipponbare, complete sequence.
GenBankCP0126174e-50CP012617.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 9 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015648772.12e-47PREDICTED: protein SHI RELATED SEQUENCE 1
TrEMBLM0Z9171e-130M0Z917_HORVD; Uncharacterized protein
STRINGMLOC_79356.11e-125(Hordeum vulgare)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75520.11e-27SHI-related sequence 5